Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042074_circ_g.1 |
| ID in PlantcircBase | zma_circ_007677 |
| Alias | Zm03circ00055, ZmciR136 |
| Organism | Zea mays |
| Position | chr3: 149692240-149692646 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d042074 |
| Parent gene annotation |
Regulator of chromosome condensation (RCC1) family with FYVE zin c finger domain |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042074_T002:2 Zm00001d042074_T009:2 Zm00001d042074_T008:2 Zm00001d042074_T001:2 Zm00001d042074_T010:2 Zm00001d042074_T004:2 Zm00001d042074_T005:2 Zm00001d042074_T003:2 Zm00001d042074_T006:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.319818714 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
149692631-149692291(+) 149692314-149692623(-) |
| Potential amino acid sequence |
MTASTRQFFRGIHGLRRNASLFL*(+) MTYHVKLEKKTGIPSQAVDTSEKLPCGCCHCC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |