Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042074_circ_g.1 |
ID in PlantcircBase | zma_circ_007677 |
Alias | Zm03circ00055, ZmciR136 |
Organism | Zea mays |
Position | chr3: 149692240-149692646 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d042074 |
Parent gene annotation |
Regulator of chromosome condensation (RCC1) family with FYVE zin c finger domain |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d042074_T002:2 Zm00001d042074_T009:2 Zm00001d042074_T008:2 Zm00001d042074_T001:2 Zm00001d042074_T010:2 Zm00001d042074_T004:2 Zm00001d042074_T005:2 Zm00001d042074_T003:2 Zm00001d042074_T006:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.319818714 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
149692631-149692291(+) 149692314-149692623(-) |
Potential amino acid sequence |
MTASTRQFFRGIHGLRRNASLFL*(+) MTYHVKLEKKTGIPSQAVDTSEKLPCGCCHCC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |