Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0376600_circ_g.1 |
ID in PlantcircBase | osa_circ_023552 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 18408910-18409394 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0376600 |
Parent gene annotation |
Similar to ER lumen protein retaining receptor. (Os04t0376600-01 ) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0376600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014276 |
PMCS | 0.125969759 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18409344-18408926(+) 18409226-18409343(-) |
Potential amino acid sequence |
MICSIALALLRRLPVPKTQMCPR*(+) MWDCLNQDDDDLLGLLGNQTPLRDCRGFFDIDDFTCKETLDLEESRESKRRRILEYPSESNQSE DGNREISSTLGTSESLGLASGGAVREQCCKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |