Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G36790_circ_g.3 |
ID in PlantcircBase | ath_circ_041254 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 14482336-14482395 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G36790 |
Parent gene annotation |
Phosphoglycolate phosphatase 1B, chloroplastic |
Parent gene strand | - |
Alternative splicing | 5_circ_ag.3 5_circ_ag.4 5_circ_ag.5 5_circ_ag.6 5_circ_ag.7 5_circ_ag.8 5_circ_ag.9 5_circ_ag.10 5_circ_ag.11 5_circ_ag.12 5_circ_ag.13 5_circ_ag.14 5_circ_ag.15 5_circ_ag.16 5_circ_ag.17 AT5G36700_circ_g.1 5_circ_ag.2 5_circ_ag.3 5_circ_ag.4 5_circ_ag.5 5_circ_ag.6 AT5G36790_circ_g.1 AT5G36790_circ_g.2 AT5G36790_circ_g.4 |
Support reads | 4 |
Tissues | leaf, aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G36790.1:1 AT5G36790.2:1 AT5G36790.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.138888886 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14482354-14482338(-) |
Potential amino acid sequence |
MEHDHDDDGKRQIELKPGFLMEHDHDDDGKRQIELKPGFLMEHDHDDDGKRQIELKPGFLMEHD HD(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |