Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G011000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000557 |
| Alias | Chr06:2411220|2411476 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 2411220-2411476 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G011000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G011000.2:1 Gorai.006G011000.3:1 Gorai.006G011000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.921530707 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2411300-2411225(+) |
| Potential amino acid sequence |
MEWLSLPVNDVRMLVNEIMSVRAKRLLHLVPVDILVKLLRVLDHQIHRAEGLSIDECEHML*(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |