Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0580100_circ_g.2 |
ID in PlantcircBase | osa_circ_002327 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 22453752-22453911 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0580100 |
Parent gene annotation |
Alg9-like mannosyltransferase family protein. (Os01t0580100-01); Similar to Dolichyl-phosphate-mannose--glycolipid alpha-mannosyl transferase-like protein. (Os01t0580100-02);Alg9-like mannosyltr ansferase family protein. (Os01t0580100-03) |
Parent gene strand | + |
Alternative splicing | Os01g0580100_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0580100-03:1 Os01t0580100-01:1 Os01t0580100-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.333332552 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22453878-22453751(+) |
Potential amino acid sequence |
MSSCFCAIHFKSENKGTLDESDRFLMNPADFVGEVFGNLSSFSHIVLFESEERHVKLLLRNSFQ E*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |