Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G009500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000226 |
| Alias | Chr03:580843|581809 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 580843-581809 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G009500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G009500.3:5 Gorai.003G009500.6:5 Gorai.003G009500.8:5 Gorai.003G009500.4:5 Gorai.003G009500.2:5 Gorai.003G009500.5:5 Gorai.003G009500.7:5 Gorai.003G009500.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.55240848 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
581743-581507(-) 581741-580932(+) |
| Potential amino acid sequence |
MKMWFNFIMHSRMIPMCILLWSYVRVENCWTGFWPSKKDSRYSEKDAAVVVRQMLKVAAECHLH GLVHRDMKPENFLFKSTRPDSPLKATDFGLSDFIKPGKRFRDIVGSAYYVAPEVLKRRSGPESD VWSIGVITYILLCGKRPFWDKTEDGIFKEMILPIAVEDVKREVKILKALKGHENVVQFYNAFED DSYVYIVMELCEGGELLDRILAK*(-) MAFQGFQYLDFSLDILDSDWKNHLLKYTILSLIPKGTLPTEQNVGNYTDTPYI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |