Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g041750.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002306 |
| Alias | 7:51415173|51415821 |
| Organism | Solanum lycopersicum |
| Position | chr7: 54091673-54092321 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc07g041750.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc07g041750.2_circ_g.1 |
| Support reads | 3/25 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc07g041750.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.890611574 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54092316-54091868(+) 54092266-54092296(-) |
| Potential amino acid sequence |
MNPFICPVGCMIKGRKYKCCLHDFSNSYHITDPKSHLI*(+) MDGDTKHSGERNHLEQTLSMVASGVVGNQNNMLDYSEIWLHPNSENFTQCIERTKSQKLVDAKT NGYLLINANGGLNQMRFGICDMVAVAKIMKATLVLPSLDHTSYWADERIHMTHWSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018 |