Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0490100_circ_g.1 |
| ID in PlantcircBase | osa_circ_024324 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 24484813-24485808 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0490100 |
| Parent gene annotation |
Similar to protoporphyrinogen IX oxidase (mitochondrial)2. (Os04 t0490100-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0490100-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.131855045 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24484941-24484857(+) 24484841-24485748(-) |
| Potential amino acid sequence |
MQSLIDALHNEVGDGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIM TVWLCHCWCHLVQTIH*(+) MAPAMTEPYSHYNSIERLVLSEIFPFSIF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |