Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0866800_circ_g.4 |
ID in PlantcircBase | osa_circ_004972 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 37537197-37537615 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0866800 |
Parent gene annotation |
Similar to F24P17.15 protein (Tubby-like protein TULP9). (Os01t0 866800-01) |
Parent gene strand | + |
Alternative splicing | Os01g0866800_circ_g.3 Os01g0866800_circ_g.5 Os01g0866800_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0866800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010966 |
PMCS | 0.317961535 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
37537251-37537265(+) 37537239-37537371(-) |
Potential amino acid sequence |
MSFRSIVRDVRDGFGSLSRRSFEVTLASLYGLTGHHKGKTQSSLDELDDSPAIIPESRWASLPP ELLREVIRRLEADESTWPSRRNVVCFAAVCRTWREMCKETVLSPEFCGKLTFPVSIKQVIFCRA SYALLSGIGWFRCRFVA*(+) MPDNKAYDALQNMTCFIETGKVSFPQNSGLNTVSLHISLHVLQTAAKQTTFLRDGHVLSSASSL RMTSRRSSGGRLAQRLSGIIAGESSSSSNEL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |