Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G158800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000280 |
| Alias | Chr03:42805727|42806490 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 42805727-42806490 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G158800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.003G158800_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AC |
| Number of exons covered | Gorai.003G158800.1:3 Gorai.003G158800.2:3 Gorai.003G158800.6:3 Gorai.003G158800.4:3 Gorai.003G158800.3:3 Gorai.003G158800.5:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.704858082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42805782-42805771(+) 42805976-42806436(-) |
| Potential amino acid sequence |
MHSVKSTTDVLELMNIGLMNRAVGATALNERSSRSHSILTVHVRGTDIKTNAVLRGSLHLVDLA GSERVDRSEATGDRLREAQHINKSLSALGDVIFALAQKNSHVPYRNSKLTQVLQSSLGGQAKTL MFVQLNPDVESYAETISTLKFAERVSGVELGAARTNREGRDIRELMEQTWDLEHHPTKWVSCP* (+) MLWDLLLLSFRAVAPTALFIKPIFINSRTSVVDFTECMLASGTANPFGWVVLQIPSLFHKFSDI SSFSVSPCST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |