Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g009600.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001644 |
| Alias | 5:3800601|3801014 |
| Organism | Solanum lycopersicum |
| Position | chr5: 3800601-3801014 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | ue-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc05g009600.2 |
| Parent gene annotation |
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subuni t A alpha isoform |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc05g009600.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.535062923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3800623-3800603(+) 3800645-3800844(-) |
| Potential amino acid sequence |
MAMVDEPLYPIAVLIDELKNDDIQLRLNSIRRLSTIARALGEERTRKELIPFLSENNDDDDEVL LAMAEELGVFIPYVGGVEHAHVLLPPLETLCTVEETCVRDKAVESLCRIGSQMRESDLVDWFVP LVKL*(+) MAHLPLPSSQDSVRASQVGRTNQLNHSPSSGIQFYTMTPQLYPSHRSPQLYKGSLEVGEEHEHA PHLQHKE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tan et al., 2017; Yin et al., 2018 |