Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0661400_circ_g.1 |
| ID in PlantcircBase | osa_circ_031852 |
| Alias | Os_ciR5527 |
| Organism | Oryza sativa |
| Position | chr6: 27258385-27258713 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0661400 |
| Parent gene annotation |
Similar to clathrin assembly protein. (Os06t0661400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0661400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.093971631 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27258648-27258426(+) |
| Potential amino acid sequence |
MWRSFRSLACIAETTTQAHFLSAWDCSVWVRTYASYLDERVECFRILKYDVEADRLVKLPQASG KAHSRTRTLPCGDLLDHLPALQRLLLRLISCQLGIALFGCAHMRPI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |