Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0519900_circ_g.1 |
| ID in PlantcircBase | osa_circ_028554 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 25814493-25815400 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0519900 |
| Parent gene annotation |
Similar to STT3A (STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE A); oligosaccharyl transferase. (Os05t0519900-01);Similar to STT 3A (STAUROSPORIN AND TEMPERATURE SENSITIVE 3-LIKE A); oligosacch aryl transferase. (Os05t0519900-02);Similar to predicted protein . (Os05t0519900-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0519900_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0519900-01:5 Os05t0519900-02:5 Os05t0519900-03:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.376073403 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25815392-25814542(+) 25815173-25815348(-) |
| Potential amino acid sequence |
MREQANCYDKSHSYFEQPGS*(+) MVCSWGGYTFIINLIPIHVLLCIVTGRYSSRLYIAYAPLVILGTLLAALVPVVGFNAVMTSEHF ASFLVFIILHVVALVYYIKGLLTPRLFKVAMTLVITVGLFPHTSQDPLQEAMIMKP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |