Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G16470_circ_g.7 |
ID in PlantcircBase | ath_circ_002906 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 5624871-5624933 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G16470 |
Parent gene annotation |
Proteasome subunit alpha type |
Parent gene strand | + |
Alternative splicing | AT1G16470_circ_g.6 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G16470.1:1 AT1G16470.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.10978836 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5624884-5624930(+) 5624924-5624873(-) |
Potential amino acid sequence |
MELDDAIHTAILTLKEGYTEDMELDDAIHTAILTLKEGYTEDMELDDAIHTAILTLKEGYTEDM ELDDAIHTAILTLKE(+) MSVSLCEWHRQVPCLLCTLLSMSVSLCEWHRQVPCLLCTLLSMSVSLCEWHRQVPCLLCTLLSM SVSLCEWHRQVPCLLC(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |