Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d035512_circ_g.6 |
| ID in PlantcircBase | zma_circ_008908 |
| Alias | zma_circ_0002459, GRMZM2G416701_C3 |
| Organism | Zea mays |
| Position | chr6: 30484035-30484945 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d035512 |
| Parent gene annotation |
Putative AP2/EREBP transcription factor superfamily protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d035512_circ_g.2 Zm00001d035512_circ_g.3 Zm00001d035512_circ_g.4 Zm00001d035512_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d035512_T002:3 Zm00001d035512_T003:3 Zm00001d035512_T004:3 Zm00001d035512_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117747064 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30484831-30484067(+) 30484905-30484934(-) 30484332-30484906(-) |
| Potential amino acid sequence |
MLRLSCRRRAALTGRSSLISWLPSIYRLGLTPSSSHTMRAYDKAAIKCNGREAVTNFEPSTYDG ELLLTAEASAEVADDVDLNLSISQPASSQSPKRDKNCLGPQLHHHHGRPFDGSAVLKKTKIDAP SELSSAGRPHRSFLPHLVAAEHLPPRSHPFFITHHEGVRQGRDQMQR*(+) MLGSHEMREERPVRAARRRQLRRSIDLGFLQNGGAVKRPPMVVVELRTKAVLVSFGALGRCRLR DAQVQINVVSNFCASFSSQQQLPVVRAGLEVRHGLSTVAFDRGLVVRPHGV*(-) MLKFRSTSSATSALASAVSSSSPSYVLGSKFVTASLPLHLIAALSYALMVCDEEGVRPRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |