Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0856000_circ_g.3 |
| ID in PlantcircBase | osa_circ_004863 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 36954750-36956283 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0856000 |
| Parent gene annotation |
Similar to CDC6 protein. (Os01t0856000-01);Similar to predicted protein. (Os01t0856000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0856000-01:7 Os01t0856000-02:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.143847072 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36956269-36954919(+) 36956163-36954774(+) 36955449-36956215(-) |
| Potential amino acid sequence |
MPKSSESRCSLWRHEKSSWCLQERCRGF*(+) MFGATKILVSHSIQQRRLYTVCIVSYTKCQQIKSNNAQKFRKSLQPLET*(+) MSQVQILDQKTLVTLLQKPLQRSCKHQELFSCLQRLQRLSELLGIIAFDLLALGIRYNANCV*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |