Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_16G147800_circ_g.1 |
| ID in PlantcircBase | gma_circ_007347 |
| Alias | gma-circRNA2242 |
| Organism | Glycine max |
| Position | chr16: 30858377-30858550 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_16G147800 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH08415:1 KRH08413:1 KRH08414:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2683 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30858400-30858547(+) |
| Potential amino acid sequence |
MPSKVIESRVYDHDGNVTGTSDSCSWDAEEKACSSDNQISSLRKDNKLQRRSKHVEKRMPSKVI ESRVYDHDGNVTGTSDSCSWDAEEKACSSDNQISSLRKDNKLQRRSKHVEKRMPSKVIESRVYD HDGNVTGTSDSCSWDAEEKACSSDNQISSLRKDNKLQRRSKHVEKRMPSKVIESRVYDHDGNVT GTSDSCSWDAEEKACSSDNQISSLRKDNKLQR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |