Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0576700_circ_g.1 |
| ID in PlantcircBase | osa_circ_012096 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 23813229-23814218 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0576700 |
| Parent gene annotation |
Similar to Diphosphonucleotide phosphatase 1 precursor. (Os12t05 76700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0576700-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153772971 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23814074-23813247(+) 23813235-23813935(-) 23814203-23814200(-) |
| Potential amino acid sequence |
MCRLVDGKDHPLDGNPRQRLLPGVHRSCGPKNQPCDHHPQPDHTPPSETSFQDFP*(+) MKSLKEEYDQAVGGGHMAGSLGRSCGAPRGAAAVEDCRREDGPCRQRVGTCQGVPFGSWAEG*( -) MIRLWVVVTWLVLWAAAAVHPGEQPLSRIAVERMVLAVNESAHVRASPLVLGLKGETNEWVEVE FFNPNPSNTDWVGVFSPADFSSAICEAYGVPQYYPMLCTAPIKYQYANFNNNGYSKSGKGKLKL QLINQREDFSFALFSGGLENPKLVAVSNKIAFANPKAPVYPRLAQGKSWNEVSEGGV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |