Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0576700_circ_g.1 |
ID in PlantcircBase | osa_circ_012096 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 23813229-23814218 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0576700 |
Parent gene annotation |
Similar to Diphosphonucleotide phosphatase 1 precursor. (Os12t05 76700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0576700-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.153772971 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23814074-23813247(+) 23813235-23813935(-) 23814203-23814200(-) |
Potential amino acid sequence |
MCRLVDGKDHPLDGNPRQRLLPGVHRSCGPKNQPCDHHPQPDHTPPSETSFQDFP*(+) MKSLKEEYDQAVGGGHMAGSLGRSCGAPRGAAAVEDCRREDGPCRQRVGTCQGVPFGSWAEG*( -) MIRLWVVVTWLVLWAAAAVHPGEQPLSRIAVERMVLAVNESAHVRASPLVLGLKGETNEWVEVE FFNPNPSNTDWVGVFSPADFSSAICEAYGVPQYYPMLCTAPIKYQYANFNNNGYSKSGKGKLKL QLINQREDFSFALFSGGLENPKLVAVSNKIAFANPKAPVYPRLAQGKSWNEVSEGGV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |