Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0242900_circ_g.1 |
ID in PlantcircBase | osa_circ_001025 |
Alias | Os_ciR6605 |
Organism | Oryza sativa |
Position | chr1: 7877196-7877536 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0242900 |
Parent gene annotation |
Similar to 60S ribosomal protein L18A. (Os01t0242900-01);Conserv ed hypothetical protein. (Os01t0242900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0242900-02:1 Os01t0242900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.285395528 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7877525-7877426(+) 7877235-7877499(-) |
Potential amino acid sequence |
MRYSARDYEAGARGHGHDRLPCCGIGIGWFLFIVGFFLGAIPWYVGAFLLWCSRVDYREKPGYV ACAIALEIMKQVLVDMVMTAFLAVGLALAGFYS*(+) MTMSTSTCFIISSAIAHATYPGFSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |