Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0242900_circ_g.1 |
| ID in PlantcircBase | osa_circ_001025 |
| Alias | Os_ciR6605 |
| Organism | Oryza sativa |
| Position | chr1: 7877196-7877536 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0242900 |
| Parent gene annotation |
Similar to 60S ribosomal protein L18A. (Os01t0242900-01);Conserv ed hypothetical protein. (Os01t0242900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0242900-02:1 Os01t0242900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.285395528 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7877525-7877426(+) 7877235-7877499(-) |
| Potential amino acid sequence |
MRYSARDYEAGARGHGHDRLPCCGIGIGWFLFIVGFFLGAIPWYVGAFLLWCSRVDYREKPGYV ACAIALEIMKQVLVDMVMTAFLAVGLALAGFYS*(+) MTMSTSTCFIISSAIAHATYPGFSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |