Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d037532_circ_g.5 |
ID in PlantcircBase | zma_circ_009044 |
Alias | Zm06circ00057, GRMZM2G021846_C2 |
Organism | Zea mays |
Position | chr6: 128412415-128414605 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d037532 |
Parent gene annotation |
6-phosphofructo-2-kinase/fructose-26-bisphosphatase |
Parent gene strand | + |
Alternative splicing | Zm00001d037532_circ_g.4 Zm00001d037532_circ_g.6 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d037532_T001:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.112024802 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
128412431-128412424(+) |
Potential amino acid sequence |
MEDMIDWMNGGGQVGIFDATNSTRKRRYMLMKMAEGNCKIIFLETICNDPNIIERNIRLKIQQS PDYAEQLDYEAGLEDFKERLINYEKVYEPVGEGSYIKMIDMVKGQDGQLQVNNISGYLPGRIVF FLVNSHLTPRPILLTRHGESLHNVRGRVGGDTVLRWLL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |