Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d037532_circ_g.5 |
| ID in PlantcircBase | zma_circ_009044 |
| Alias | Zm06circ00057, GRMZM2G021846_C2 |
| Organism | Zea mays |
| Position | chr6: 128412415-128414605 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d037532 |
| Parent gene annotation |
6-phosphofructo-2-kinase/fructose-26-bisphosphatase |
| Parent gene strand | + |
| Alternative splicing | Zm00001d037532_circ_g.4 Zm00001d037532_circ_g.6 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d037532_T001:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112024802 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
128412431-128412424(+) |
| Potential amino acid sequence |
MEDMIDWMNGGGQVGIFDATNSTRKRRYMLMKMAEGNCKIIFLETICNDPNIIERNIRLKIQQS PDYAEQLDYEAGLEDFKERLINYEKVYEPVGEGSYIKMIDMVKGQDGQLQVNNISGYLPGRIVF FLVNSHLTPRPILLTRHGESLHNVRGRVGGDTVLRWLL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |