Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0016s14250_circ_g.2 |
| ID in PlantcircBase | pop_circ_003924 |
| Alias | Chr16:13848592|13849970 |
| Organism | Populus trichocarpa |
| Position | chr16: 13501142-13502520 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | POPTR_0016s14250 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | POPTR_0016s14250_circ_g.1 |
| Support reads | NA |
| Tissues | stem cambium |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0016s14250.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.524446809 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13501243-13501179(+) 13501168-13502389(-) 13501245-13502451(-) |
| Potential amino acid sequence |
MEIKHYVQDIGNQRFSDTEGHMSSGPMKLKDKASPMISPYFFDVTVIFRRRGGDDLEQNHIRWA RTVESSPDVIEMTFVPIADLLVGVPGKEHLSRAIALYLESSLKILGRMLSLL*(+) MRPKIFNEDSRYRAIARLRCSFPGTPTRRSAIGTKVISMTSGDDSTVLAHRI*(-) MVDKGDDWCCLTYITSLPPIVTEVITCVPKFSMKIQDIEQLHDSDAPFQAPQQGDLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zheng et al., 2020 |