Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0638100_circ_g.2 |
| ID in PlantcircBase | osa_circ_012503 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 27343368-27343784 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0638100 |
| Parent gene annotation |
Similar to Receptor-like protein kinase. (Os12t0638100-01);Simil ar to ATP binding protein. (Os12t0638100-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0638100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.181313669 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27343650-27343402(+) 27343777-27343427(+) 27343428-27343708(-) |
| Potential amino acid sequence |
MDWTLRSGKEQEMPSQPQGLGSVGFQVVSRWLLPLKESLSSSNACHSLQLVELPNVR*(+) MPAILCSLSSFPMLGEMMPPSCM*(+) MQLGGIISPNIGKLDKLQRMAGIAGAQALLQWQQPAADDLEAHRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |