Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0106900_circ_g.1 |
ID in PlantcircBase | osa_circ_000069 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 376003-377381 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0106900 |
Parent gene annotation |
Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Frag ment). (Os01t0106900-01);Similar to 1-deoxy-D-xylulose 5-phospha te reductoisomerase (Fragment). (Os01t0106900-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0106900-02:5 Os01t0106900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.161874764 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
377169-377338(-) 376038-377222(-) |
Potential amino acid sequence |
MGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMR IPILYTMSWPDRIYCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAA NEKAVELFIDENVYKACPKEHFAALF*(-) MRRLWSCSSMKMYTRLARRSTSPHYFDCIRWCFQGLAS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |