Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0106900_circ_g.1 |
| ID in PlantcircBase | osa_circ_000069 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 376003-377381 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0106900 |
| Parent gene annotation |
Similar to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Frag ment). (Os01t0106900-01);Similar to 1-deoxy-D-xylulose 5-phospha te reductoisomerase (Fragment). (Os01t0106900-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0106900-02:5 Os01t0106900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161874764 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
377169-377338(-) 376038-377222(-) |
| Potential amino acid sequence |
MGKKITVDSATLFNKGLEVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMR IPILYTMSWPDRIYCSEVTWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAA NEKAVELFIDENVYKACPKEHFAALF*(-) MRRLWSCSSMKMYTRLARRSTSPHYFDCIRWCFQGLAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |