Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G188300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000644 |
| Alias | Chr06:44502165|44504501 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 44502165-44504501 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G188300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G188300.1:5 Gorai.006G188300.4:4 Gorai.006G188300.2:5 Gorai.006G188300.3:4 Gorai.006G188300.5:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100731629 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
44502618-44502188(+) 44502673-44504498(-) |
| Potential amino acid sequence |
MAILEESVVDSKISPPNSYGAVVLGGTFDRLHDGHRLFLRYSDLIEPVEERMHNVECYIKSIKP ELVVHVGPITDPYGPSIVDENLDAIVVSKETIPGGISVNRKRADRGLSQLKVSDRARKY*(+) MNLVEKSLNPLLIPPKLPFFFFLVFLIFPCSIRYL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |