Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0729801_circ_g.1 |
| ID in PlantcircBase | osa_circ_016395 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30382060-30382551 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os02g0729801 |
| Parent gene annotation |
Hypothetical protein. (Os02t0729801-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0729801_circ_g.2 |
| Support reads | 37 |
| Tissues | root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0729700-01:2 Os02t0729700-02:2 Os02t0729700-01:2 Os02t0729801-00:1 Os02t0729700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012243 |
| PMCS | 0.352386856 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30382081-30382387(+) 30382319-30382550(-) 30382083-30382480(-) |
| Potential amino acid sequence |
MEEGGRGVKRPFFTTPDELLEEEYYDEQLPEKKRRLTPEQVHLLERSFEEENKLEPERKTELAR KLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQGRDRCSAW RKEGAASSGPSSPPPTSSSKRSTTTSSSRRRSGASRRSRCICWRGASRRRTSWSRSGRRSWRGS *(+) MHLLRREAPLLLRELLVVVLLFEELVGGGEEGPLDAAPSFLHAEHRSRP*(-) MPSTGLAPESGGGGCPGGGRRGRRGGRRTTP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |