Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0729801_circ_g.1 |
ID in PlantcircBase | osa_circ_016395 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30382060-30382551 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os02g0729801 |
Parent gene annotation |
Hypothetical protein. (Os02t0729801-00) |
Parent gene strand | - |
Alternative splicing | Os02g0729801_circ_g.2 |
Support reads | 37 |
Tissues | root, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0729700-01:2 Os02t0729700-02:2 Os02t0729700-01:2 Os02t0729801-00:1 Os02t0729700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012243 |
PMCS | 0.352386856 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30382081-30382387(+) 30382319-30382550(-) 30382083-30382480(-) |
Potential amino acid sequence |
MEEGGRGVKRPFFTTPDELLEEEYYDEQLPEKKRRLTPEQVHLLERSFEEENKLEPERKTELAR KLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQGRDRCSAW RKEGAASSGPSSPPPTSSSKRSTTTSSSRRRSGASRRSRCICWRGASRRRTSWSRSGRRSWRGS *(+) MHLLRREAPLLLRELLVVVLLFEELVGGGEEGPLDAAPSFLHAEHRSRP*(-) MPSTGLAPESGGGGCPGGGRRGRRGGRRTTP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |