Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G33650_circ_g.9 |
| ID in PlantcircBase | ath_circ_034466 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 16164035-16164565 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder |
| Parent gene | AT4G33650 |
| Parent gene annotation |
NOXY15 |
| Parent gene strand | + |
| Alternative splicing | AT4G33650_circ_g.1 AT4G33650_circ_g.2 AT4G33650_circ_g.3 AT4G33650_circ_g.4 AT4G33650_circ_g.5 AT4G33650_circ_g.6 AT4G33650_circ_g.7 AT4G33650_circ_g.8 AT4G33650_circ_g.10 AT4G33650_circ_g.11 AT4G33650_circ_g.12 AT4G33650_circ_g.13 AT4G33650_circ_g.14 AT4G33650_circ_g.15 AT4G33650_circ_g.16 AT4G33650_circ_g.17 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G33650.2:3 AT4G33650.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.353675766 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16164443-16164562(+) |
| Potential amino acid sequence |
MMNELQRFPVLRKRMDEVIGDFLREGLEPSEAMIGDIIDMEEVDPCEDLTDDDIRTAIQNATGP RSALFVPDVPFEVLVRRQISRLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIG DFLREGLEPSEAMIGDIIDMEEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLVRRQIS RLLDPSLQCARFIFEELIKISHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSEAMIGDIIDM EEVDPCEDLTDDDIRTAIQNATGPRSALFVPDVPFEVLVRRQISRLLDPSLQCARFIFEELIKI SHRCMMNELQRFPVLRKRMDEVIGDFLREGLEPSEAMIGDIIDME(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |