Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0512200_circ_g.1 |
| ID in PlantcircBase | osa_circ_034025 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 19626830-19627919 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0512200 |
| Parent gene annotation |
Similar to Symbiosis-related like protein. (Os07t0512200-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0512200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105736758 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19627914-19626854(-) |
| Potential amino acid sequence |
MARTSFKLEHPLERRQAESARIREKYSDRIPVGDGQDFLQARAPTGKEASRICQDP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |