Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0818000_circ_g.1 |
ID in PlantcircBase | osa_circ_004597 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 34834581-34834695 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0818000 |
Parent gene annotation |
Auxin efflux carrier domain containing protein. (Os01t0818000-01 );Auxin efflux carrier domain containing protein. (Os01t0818000- 02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AT |
Number of exons covered | Os01t0818000-01:1 Os01t0818000-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.181361594 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34834638-34834586(-) |
Potential amino acid sequence |
MPSSSPSREIELEALEIKLAWPRTRRRRRRLRAREEGDNALVVPFTRDRTRSARD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |