Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0284900_circ_g.6 |
| ID in PlantcircBase | osa_circ_019230 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 9817083-9817325 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0284900 |
| Parent gene annotation |
Annexin repeat, conserved site domain containing protein. (Os03t 0284900-01);Annexin repeat, conserved site domain containing pro tein. (Os03t0284900-02);Hypothetical conserved gene. (Os03t02849 00-03);Similar to cDNA clone:001-032-C02, full insert sequence. (Os03t0284900-04) |
| Parent gene strand | - |
| Alternative splicing | Os03g0284900_circ_g.7 Os03g0284900_circ_g.8 Os03g0284900_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0284900-04:2 Os03t0284900-01:2 Os03t0284900-03:2 Os03t0284900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.388929184 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9817102-9817322(+) 9817315-9817085(-) |
| Potential amino acid sequence |
MCFHFFKQVQCQLQVFVFNACLNSNSICSDIKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQV FVFNACLNSNSICSDIKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQVFVFNACLNSNSICSD IKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQVFVFNACLNSNSICSDIKFHSNTLHSSEC(+ ) MQRVGMKLNVTAYTVAIKACVENKDLKLALHLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTV AIKACVENKDLKLALHLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTVAIKACVENKDLKLAL HLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTVAIKACVENKDLKLALHLFEEMKAHQLKPNL (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |