Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0284900_circ_g.6 |
ID in PlantcircBase | osa_circ_019230 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9817083-9817325 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0284900 |
Parent gene annotation |
Annexin repeat, conserved site domain containing protein. (Os03t 0284900-01);Annexin repeat, conserved site domain containing pro tein. (Os03t0284900-02);Hypothetical conserved gene. (Os03t02849 00-03);Similar to cDNA clone:001-032-C02, full insert sequence. (Os03t0284900-04) |
Parent gene strand | - |
Alternative splicing | Os03g0284900_circ_g.7 Os03g0284900_circ_g.8 Os03g0284900_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0284900-04:2 Os03t0284900-01:2 Os03t0284900-03:2 Os03t0284900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.388929184 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9817102-9817322(+) 9817315-9817085(-) |
Potential amino acid sequence |
MCFHFFKQVQCQLQVFVFNACLNSNSICSDIKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQV FVFNACLNSNSICSDIKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQVFVFNACLNSNSICSD IKFHSNTLHSSECQIGFQLMCFHFFKQVQCQLQVFVFNACLNSNSICSDIKFHSNTLHSSEC(+ ) MQRVGMKLNVTAYTVAIKACVENKDLKLALHLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTV AIKACVENKDLKLALHLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTVAIKACVENKDLKLAL HLFEEMKAHQLKPNLALRRMQRVGMKLNVTAYTVAIKACVENKDLKLALHLFEEMKAHQLKPNL (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |