Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0507500_circ_g.3 |
| ID in PlantcircBase | osa_circ_024512 |
| Alias | Os_ciR4821 |
| Organism | Oryza sativa |
| Position | chr4: 25352214-25352477 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0507500 |
| Parent gene annotation |
Armadillo-like helical domain containing protein. (Os04t0507500- 01);Similar to OSIGBa0157A06.7 protein. (Os04t0507500-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0507500_circ_g.1 Os04g0507500_circ_g.2 Os04g0507500_circ_g.4 Os04g0507500_circ_g.5 Os04g0507500_circ_g.6 Os04g0507500_circ_g.7 Os04g0507500_circ_g.8 Os04g0507500_circ_g.9 Os04g0507500_circ_g.10 Os04g0507500_circ_g.11 |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0507500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.395136679 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25352389-25352216(-) |
| Potential amino acid sequence |
MLNNQSGAMEESIEIVLEKLLHVTKDMVAKYFNQILTAVLEVLDDSDSSTREIALSLVAEMLNN QSGAMEESIEIVLEKLLHVTKDMVAKYFNQILTAVLEVLDDSDSSTREIALSLVAEMLNNQSGA MEESIEIVLEKLLHVTKDMVAKYFNQILTAVLEVLDDSDSSTREIALSLVAEMLNNQSGAMEES IEIVLEKLLHVTKDMVAK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |