Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0340600_circ_g.1 |
| ID in PlantcircBase | osa_circ_006488 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 10014870-10014957 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE |
| Parent gene | Os10g0340600 |
| Parent gene annotation |
Similar to Beta-galactosidase. (Os10t0340600-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0340600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.699385985 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10014916-10014892(+) 10014955-10014898(-) |
| Potential amino acid sequence |
MGLLQCGQSWYHHGTYSSKGAS*(+) MVVPTLAALQEAHILQQAMIMMLPWMSMYHGGTNFGRTAGGPYITTSYDYDAPLDEYVPWWYQL WPHCRRPIYYNKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |