Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G45540_circ_g.6 |
ID in PlantcircBase | ath_circ_018534 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 18761176-18761469 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G45540 |
Parent gene annotation |
BEACH domain-containing protein C2 |
Parent gene strand | - |
Alternative splicing | AT2G45540_circ_g.4 AT2G45540_circ_g.5 AT2G45540_circ_g.7 AT2G45540_circ_g.8 AT2G45540_circ_g.9 AT2G45540_circ_g.10 AT2G45540_circ_g.11 |
Support reads | 1 |
Tissues | aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G45540.1:2 AT2G45540.2:2 AT2G45540.5:2 AT2G45540.4:2 AT2G45540.6:2 AT2G45540.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215121201 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18761200-18761178(-) |
Potential amino acid sequence |
MERWARWENTEGRRNAYRAIVQARPPHLNNIYLATQRPEQLLRRTQLMERWARWENTEGRRNAY RAIVQARPPHLNNIYLATQRPEQLLRRTQLMERWARWENTEGRRNAYRAIVQARPPHLNNIYLA TQRPEQLLRRTQLMERWARWE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |