Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0442300_circ_g.2 |
| ID in PlantcircBase | osa_circ_039359 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 16439535-16439850 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0442300 |
| Parent gene annotation |
Similar to Oryzain gamma chain (Fragment). (Os09t0442300-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0442300_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0442300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.400394198 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16439744-16439743(+) 16439540-16439653(-) |
| Potential amino acid sequence |
MSWEEFQASRLGAAQNCSATLAGNHRMRDAAALPETAWEEVRRRGGGAAAVPDLLREPRARPLH QPEGPPLPPRHQPFRGHELGGVPGEPARRGAELLGDARRQPPDARRRRSPGDRMGRGTATRRRC SGGSGSSPRASSSSAPPTGGASPTASASTVSRT*(+) MRSPGERRRRASGGCRRASPSSSAPRRAGSPGTPPSSCPRNG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |