Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0006s24250_circ_g.1 |
| ID in PlantcircBase | pop_circ_001993 |
| Alias | Chr06:23760890-23761461 |
| Organism | Populus trichocarpa |
| Position | chr6: 22894959-22895530 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0006s24250 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0006s24250.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135934863 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22895008-22894978(+) 22894973-22895465(-) 22895462-22895506(-) 22895413-22895469(-) |
| Potential amino acid sequence |
MDIIGALLMLKALSLAPVSVIQPVSGCGLAILSVFSHFYLKEVMNVIDWMGITLAGIGTIGDKG ICC*(+) MPLSPIVPIPAKVIPIQSMTFMTSFR*(-) MGKDRKNSKSTTRNWLDDRNRSQRQCLQHQQCTNNIHKKTNDPSYISSICPYHLLYQYQPK*(- ) MTETGARDNAFNINNAPIISIRKPMIQATLAAYALITYCTNTSQSDPHPINDIHDFL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |