Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0565600_circ_g.6 |
ID in PlantcircBase | osa_circ_020483 |
Alias | Os_ciR8634 |
Organism | Oryza sativa |
Position | chr3: 20423037-20423304 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0565600 |
Parent gene annotation |
Similar to tobamovirus multiplication-like protein. (Os03t056560 0-01) |
Parent gene strand | - |
Alternative splicing | Os03g0565600_circ_g.1 Os03g0565600_circ_g.2 Os03g0565600_circ_g.3 Os03g0565600_circ_g.4 Os03g0565600_circ_g.5 Os03g0565600_circ_g.7 Os03g0565600_circ_g.8 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0565600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.210568097 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20423254-20423050(+) 20423071-20423039(-) |
Potential amino acid sequence |
MSRKIEDQEDPITPKYTPGLHI*(+) MAVNGVIYVIQVYTLVLLDLPGLLFFSTYTLLVLFWAEIYHQAKNLPTDKLRIIYMAVNGVIYV IQVYTLVLLDLPGLLFFSTYTLLVLFWAEIYHQAKNLPTDKLRIIYMAVNGVIYVIQVYTLVLL DLPGLLFFSTYTLLVLFWAEIYHQAKNLPTDKLRIIYMAVNGVIYVIQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |