Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0658300_circ_g.9 |
| ID in PlantcircBase | osa_circ_035106 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 27719633-27720879 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0658300 |
| Parent gene annotation |
Rho GTPase-activating protein, Target of the E3 ligase SPL11, Ne gative regulation of programmed cell death and innate immunity ( Os07t0658300-01);Splicing isoform of SPIN6 (Os07t0658300-02);Spl icing isoform of SPIN6 (Os07t0658300-03) |
| Parent gene strand | + |
| Alternative splicing | Os07g0658300_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0658300-01:5 Os07t0658300-02:5 Os07t0658300-03:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.19440973 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27720575-27720568(+) 27720823-27719661(+) 27719671-27720766(-) |
| Potential amino acid sequence |
MSSAHISSSRSMDSKTKAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYGSLADANDRYQH LPNHLPQEEKVNSQNWLIHRVKKSLLSKDWRSQRMTSRSESRKRLEEMQSYKQVWKEENKHYMS AVWLWSRMFQGCKSSYKLKEILELHWRLD*(+) MALWQMQMIVINIFQTISHRKKKSTVRIG*(+) MNQPILTVDFFFLWEMVWKMLITIICICQRAILMLTLLVELEMELRNLLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |