Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G268300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000983 |
| Alias | Chr09:22340934|22341674 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 22340934-22341674 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G268300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 14 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G268300.1:3 Gorai.009G268300.5:1 Gorai.009G268300.3:3 Gorai.009G268300.2:3 Gorai.009G268300.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000095 |
| PMCS | 0.644560054 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22341020-22341466(-) 22341088-22341582(-) 22341631-22340958(+) |
| Potential amino acid sequence |
MVKSIFARFLLHVYPGEALITEMWLEGSRTSVFLRGAGGFSDPSKPFTYSNYPVNPASAMKIPK TQPSAVFEDCTQPPQACSNNTRILSLRAFMLLSK*(-) MDCVPLGLRYGLSSNVFAGEIQTWSKASLHGSFCMCILVKHSSPRCGLKARGQVFFYVVLVASQ IHLSPLHTQTIQSIRLQL*(-) MDLRSHQHHVEKHLSSSLQATSR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |