Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0178100_circ_g.5 |
| ID in PlantcircBase | osa_circ_036125 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 4578190-4579527 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0178100 |
| Parent gene annotation |
Pep3/Vps18/deep orange domain containing protein. (Os08t0178100- 01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0178100_circ_g.2 Os08g0178100_circ_g.3 Os08g0178100_circ_g.4 Os08g0178100_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0178100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147379615 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4578709-4578192(+) 4578267-4579465(-) |
| Potential amino acid sequence |
MRACVRIYSMMSMHEEAVALALTVDLELAKAEADKVEDDEELRKKLWLKVAKHVIEQEKGVKRE NIKKAIEFLSETNNLLKIEDILPFFPDFVLIDDFKEEICKSLKDYDSQIDQLKQEMDDATRGAD NIRSDIGALAQRYTVIDREEECGE*(+) MHSRILIVQIFYTEFQVLDNFMCFIPHIPPHDQLQCISEQGHQYHF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |