Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0178100_circ_g.5 |
ID in PlantcircBase | osa_circ_036125 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 4578190-4579527 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0178100 |
Parent gene annotation |
Pep3/Vps18/deep orange domain containing protein. (Os08t0178100- 01) |
Parent gene strand | + |
Alternative splicing | Os08g0178100_circ_g.2 Os08g0178100_circ_g.3 Os08g0178100_circ_g.4 Os08g0178100_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0178100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147379615 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4578709-4578192(+) 4578267-4579465(-) |
Potential amino acid sequence |
MRACVRIYSMMSMHEEAVALALTVDLELAKAEADKVEDDEELRKKLWLKVAKHVIEQEKGVKRE NIKKAIEFLSETNNLLKIEDILPFFPDFVLIDDFKEEICKSLKDYDSQIDQLKQEMDDATRGAD NIRSDIGALAQRYTVIDREEECGE*(+) MHSRILIVQIFYTEFQVLDNFMCFIPHIPPHDQLQCISEQGHQYHF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |