Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003655_circ_g.3 |
ID in PlantcircBase | zma_circ_007176 |
Alias | Zm02circ00049, zma_circ_0000729, GRMZM2G013283_C2 |
Organism | Zea mays |
Position | chr2: 52527804-52528811 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d003655 |
Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH7 chloroplastic |
Parent gene strand | + |
Alternative splicing | Zm00001d003655_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d003655_T025:2 Zm00001d003655_T003:2 Zm00001d003655_T028:2 Zm00001d003655_T027:2 Zm00001d003655_T026:2 Zm00001d003655_T006:2 Zm00001d003655_T005:2 Zm00001d003655_T014:2 Zm00001d003655_T004:2 Zm00001d003655_T012:2 Zm00001d003655_T010:2 Zm00001d003655_T016:2 Zm00001d003655_T024:2 Zm00001d003655_T009:2 Zm00001d003655_T018:2 Zm00001d003655_T019:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.096796412 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
52527809-52527860(+) 52528781-52527860(+) 52527811-52527834(-) |
Potential amino acid sequence |
MRLQFGTLLADIGLIDLPKDTLRHKVGSRKNNLESWFSNMSLPFNAYARCTSVIKGHASSVWYL VSRHWTYRSS*(+) MPMLAAPRLLRDMRLQFGTLLADIGLIDLPKDTLRHKVGSRKNNLESWFSNMSLPFNAYARCTS VIKGHASSVWYLVSRHWTYRSS*(+) MSLNNRGAASIGIEWKRHIRKPALEIIFSTAHLVPQSIFRKIYKSNVC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |