Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G79830_circ_g.1 |
| ID in PlantcircBase | ath_circ_011109 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 30028197-30028271 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G79830 |
| Parent gene annotation |
Golgin Putative 5 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G79830.3:1 AT1G79830.2:1 AT1G79830.5:1 AT1G79830.4:1 AT1G79830.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.282219447 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30028233-30028199(-) 30028210-30028268(+) |
| Potential amino acid sequence |
MYREQVNMLVNKLEELRADIVDLKEMYREQVNMLVNKLEELRADIVDLKEMYREQVNMLVNKLE ELRADIVDLKEMYREQVNMLVNK(-) MFTCSLYISFKSTISARSSSNLFTSMFTCSLYISFKSTISARSSSNLFTSMFTCSLYISFKSTI SARSSSNLFTSMFTCSLYISFKSTISARSSS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |