Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G79830_circ_g.1 |
ID in PlantcircBase | ath_circ_011109 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 30028197-30028271 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G79830 |
Parent gene annotation |
Golgin Putative 5 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | leaf, inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G79830.3:1 AT1G79830.2:1 AT1G79830.5:1 AT1G79830.4:1 AT1G79830.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.282219447 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30028233-30028199(-) 30028210-30028268(+) |
Potential amino acid sequence |
MYREQVNMLVNKLEELRADIVDLKEMYREQVNMLVNKLEELRADIVDLKEMYREQVNMLVNKLE ELRADIVDLKEMYREQVNMLVNK(-) MFTCSLYISFKSTISARSSSNLFTSMFTCSLYISFKSTISARSSSNLFTSMFTCSLYISFKSTI SARSSSNLFTSMFTCSLYISFKSTISARSSS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |