Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0642100_circ_g.1 |
ID in PlantcircBase | osa_circ_025583 |
Alias | Os_ciR9614 |
Organism | Oryza sativa |
Position | chr4: 32684986-32685249 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0642100 |
Parent gene annotation |
Microtubule-associated protein EB1. (Os04t0642100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0642100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014928 |
PMCS | 0.386640783 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32685017-32685246(+) |
Potential amino acid sequence |
MDMVHPGVVPMHKVNFDAKTEYDMIQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMH KVNFDAKTEYDMIQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMHKVNFDAKTEYDM IQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMHKVNFDAKTEYDMIQNYKILQDVFN KLRLSK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |