Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0642100_circ_g.1 |
| ID in PlantcircBase | osa_circ_025583 |
| Alias | Os_ciR9614 |
| Organism | Oryza sativa |
| Position | chr4: 32684986-32685249 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0642100 |
| Parent gene annotation |
Microtubule-associated protein EB1. (Os04t0642100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0642100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014928 |
| PMCS | 0.386640783 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32685017-32685246(+) |
| Potential amino acid sequence |
MDMVHPGVVPMHKVNFDAKTEYDMIQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMH KVNFDAKTEYDMIQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMHKVNFDAKTEYDM IQNYKILQDVFNKLRLSKAASGAVQCQLMDMVHPGVVPMHKVNFDAKTEYDMIQNYKILQDVFN KLRLSK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |