Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0516350_circ_g.1 |
| ID in PlantcircBase | osa_circ_007668 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 19909485-19910960 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0516350 |
| Parent gene annotation |
Hypothetical gene. (Os10t0516350-00) |
| Parent gene strand | - |
| Alternative splicing | Os10g0516350_circ_g.2 Os10g0516350_circ_g.3 Os10g0516350_circ_g.4 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0516300-01:6 Os10t0516300-01:6 Os10t0516350-00:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.166856544 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19910199-19909957(+) 19909559-19910937(-) |
| Potential amino acid sequence |
MTLLAEGCRGSLSEKIIRNHKLRESGQGQHQTYALGIKEVWEIEEGKHKPGSVIHTVGWPLDSK TYGGSFMYHLDDRQTPIRVPVSSDKFWLLTKNKAWTLPSPFDNKGNYVISLSQMVRWMASKAEE LGVEVYPGFAASEALQPMMLVLLKMVPKGKLFNLVLN*(+) MEVSMPYSLSTARTCQMRRGLLLGSVYHQGDT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |