Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0143900_circ_g.4 |
| ID in PlantcircBase | osa_circ_029657 |
| Alias | Os_ciR10455 |
| Organism | Oryza sativa |
| Position | chr6: 2323512-2324184 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0143900 |
| Parent gene annotation |
Similar to Coatomer protein complex, beta prime; beta'-COP prote in. (Os06t0143900-01);Similar to Coatomer complex subunit. (Os06 t0143900-02);Similar to Coatomer complex subunit. (Os06t0143900- 03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0143900-01:2 Os06t0143900-02:2 Os06t0143900-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gma_circ_007152* |
| PMCS | 0.202270295 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2324090-2323523(+) 2324182-2324160(-) |
| Potential amino acid sequence |
MDGKISFARSISPRITSVLYSIKLRSNVYPMTLCNF*(+) MGYTLLLSLIEYKTLVMRGDIERANDILPSIPKAQYNNVAHFLESRGMLEEALEIATDADYRFD LAVQLGKLEVAKCHGVHITS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |