Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0729100_circ_g.1 |
ID in PlantcircBase | osa_circ_003761 |
Alias | Os_ciR2345 |
Organism | Oryza sativa |
Position | chr1: 30400528-30401330 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0729100 |
Parent gene annotation |
Protein of unknown function DUF92, transmembrane family protein. (Os01t0729100-01);Similar to uncharacterized conserved membrane protein. (Os01t0729100-02) |
Parent gene strand | + |
Alternative splicing | Os01g0729100_circ_g.2 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0729100-01:3 Os01t0729100-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002367* osi_circ_010670 |
PMCS | 0.391498236 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30401231-30400546(+) |
Potential amino acid sequence |
MYHKAQYVSLHPRLQIFVRVILVPHYKIKKVLNGAQQQLS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |