Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0729100_circ_g.1 |
| ID in PlantcircBase | osa_circ_003761 |
| Alias | Os_ciR2345 |
| Organism | Oryza sativa |
| Position | chr1: 30400528-30401330 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0729100 |
| Parent gene annotation |
Protein of unknown function DUF92, transmembrane family protein. (Os01t0729100-01);Similar to uncharacterized conserved membrane protein. (Os01t0729100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0729100_circ_g.2 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0729100-01:3 Os01t0729100-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002367* osi_circ_010670 |
| PMCS | 0.391498236 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30401231-30400546(+) |
| Potential amino acid sequence |
MYHKAQYVSLHPRLQIFVRVILVPHYKIKKVLNGAQQQLS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |