Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g079720.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000180 |
| Alias | 1:71341928|71346648 |
| Organism | Solanum lycopersicum |
| Position | chr1: 78831122-78835842 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g079720.2 |
| Parent gene annotation |
Protein phosphatase 2C 70 |
| Parent gene strand | - |
| Alternative splicing | Solyc01g079720.2_circ_g.1 Solyc01g079720.2_circ_g.2 Solyc01g079720.2_circ_g.4 |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc01g079720.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124035148 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
78831209-78835817(-) 78835532-78835755(-) |
| Potential amino acid sequence |
MPWPYVEEERSCLWKMFAITIGLFRERISRQFCSGCL*(-) MLEVISGPCQGLQHSMQSTDTSRLPLTLGRVTPSDILVMDSEVSGKHAMINWNINKLRWELVDM GSLNGTLVNSNAVHNPHSGSRQWGDPIELANGDIITLGTTSRIFVHIRSQNDHVPFGIGIASDA MAVRRGGKKLPMEDVCYYHWPLPGTDKPTVLFWMFVILQKISLLGRRLSVHLCLIS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |