Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A01G0720_circ_g.1 |
| ID in PlantcircBase | ghi_circ_000056 |
| Alias | A01:13752665|13753101 |
| Organism | Gossypium hirsutum |
| Position | chrA01: 13752665-13753101 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_A01G0720 |
| Parent gene annotation |
SIMILAR TO: AT3G13180, NOL1/NOP2/sun family protein / antitermin ation NusB domain-containing protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gh_A01G0720:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000799* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13753064-13752667(-) |
| Potential amino acid sequence |
MPPYAVVDENVKLAKVALRPGAGNMVNGILRKLVLVKENNSLPLPKLEGDSRTQARALATLYSH PVVLRIGFYEIVKLNMPPYAVVDENVKLAKVALRPGAGNMVNGILRKLVLVKENNSLPLPKLEG DSRTQARALATLYSHPVVLRIGFYEIVKLNMPPYAVVDENVKLAKVALRPGAGNMVNGILRKLV LVKENNSLPLPKLEGDSRTQARALATLYSHPVVLRIGFYEIVKLNMPPYAVVDENVKLAKVALR PGAGNMVNGILRKLVLVKENNSLPLPKLEGDSRTQARALATLYSHPV(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |