Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0572000_circ_g.2 |
| ID in PlantcircBase | osa_circ_008104 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 22681582-22681769 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0572000 |
| Parent gene annotation |
GTP-binding protein, HSR1-related domain containing protein. (Os 10t0572000-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0572000-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223014184 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22681712-22681612(+) 22681600-22681599(+) 22681680-22681707(-) |
| Potential amino acid sequence |
MQCHPAVTIIKGNMLQIIPKSNQGFHDAGV*(+) MMQEFEIAQFLLAILNSRETYKKWENMNQAGDMPSFSHAMSSSSHHNKRQYASDHTQEQSRIP* (+) MFSHFLYVSLEFKIASRNWAISNSCIMESLIALGYDLKHIAFYYGDCWMTLHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |