Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0170400_circ_g.6 |
ID in PlantcircBase | osa_circ_008610 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 3426241-3429397 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0170400 |
Parent gene annotation |
Conserved hypothetical protein. (Os11t0170400-01);Conserved hypo thetical protein. (Os11t0170400-02) |
Parent gene strand | + |
Alternative splicing | Os11g0170400_circ_g.1 Os11g0170400_circ_g.2 Os11g0170400_circ_g.3 Os11g0170400_circ_g.4 Os11g0170400_circ_g.5 Os11g0170400_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0170400-01:7 Os11t0170400-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215878896 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3429299-3426278(+) |
Potential amino acid sequence |
MEEMNLMVIFSLLGGVSDNSVCCHISIKQNVPTVAASLQDGAELGG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |