Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0170400_circ_g.6 |
| ID in PlantcircBase | osa_circ_008610 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 3426241-3429397 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0170400 |
| Parent gene annotation |
Conserved hypothetical protein. (Os11t0170400-01);Conserved hypo thetical protein. (Os11t0170400-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0170400_circ_g.1 Os11g0170400_circ_g.2 Os11g0170400_circ_g.3 Os11g0170400_circ_g.4 Os11g0170400_circ_g.5 Os11g0170400_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0170400-01:7 Os11t0170400-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215878896 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3429299-3426278(+) |
| Potential amino acid sequence |
MEEMNLMVIFSLLGGVSDNSVCCHISIKQNVPTVAASLQDGAELGG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |