Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G28350_circ_g.3 |
| ID in PlantcircBase | ath_circ_040891 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 10325624-10325984 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | AT5G28350 |
| Parent gene annotation |
Quinoprotein amine dehydrogenase, beta chain-like RIC1-like guan yl-nucleotide exchange factor |
| Parent gene strand | + |
| Alternative splicing | AT5G28350_circ_g.2 AT5G28350_circ_g.4 |
| Support reads | 6 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G28350.1:2 AT5G28350.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.185897784 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10325922-10325981(+) |
| Potential amino acid sequence |
MSGKELSKLVAFVKGTQFDIVVRFLLRSGRDIEQAPTESDSLSPKLLGFLIFGSSHKKSSLDKS SSFKEQSPHVASVKSILESHASYLMSGKELSKLVAFVKGTQFDIVVRFLLRSGRDIEQAPTESD SLSPKLLGFLIFGSSHKKSSLDKSSSFKEQSPHVASVKSILESHASYLMSGKELSKLVAFVKGT QFDIVVRFLLRSGRDIEQAPTESDSLSPKLLGFLIFGSSHKKSSLDKSSSFKEQSPHVASVKSI LESHASYLMSGKELSKLVAFVKGTQFDIV(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |