Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc11g017470.1_circ_g.2 |
| ID in PlantcircBase | sly_circ_003327 |
| Alias | 11:8422662|8422939 |
| Organism | Solanum lycopersicum |
| Position | chr11: 8422662-8422939 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI, circseq_cup |
| Parent gene | Solyc11g017470.1 |
| Parent gene annotation |
NAC4 domain protein |
| Parent gene strand | - |
| Alternative splicing | Solyc11g017470.1_circ_g.1 |
| Support reads | 75 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc11g017470.1.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.264814447 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8422795-8422666(-) |
| Potential amino acid sequence |
MGIKKALVFYAGKAPKGEKTNWIMHEYRLAHVDRSARNKNNSLRIWLCMVRKSGISFRREIGSI RTVHGRTELRGVDTGRRRVRISRLVVQSRWELRKLWCFTQEKLRREKKQIGLCTNIDLLMLIDL LVTKTTA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Tan et al., 2017; Yin et al., 2018 |